SCOPe 2.03: Domain d1dmla2: 1dml A:170-319

Lineage for d1dmla2 (1dml A:170-319)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein UL42 [55987] (1 species)

7. Species Human herpesvirus type 1 [TaxId:10298] [55988] (1 PDB entry)

8. Domain d1dmla2: 1dml A:170-319 [41381]
   protein/DNA complex

Details for d1dmla2

PDB Entry: 1dml, 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1dmla2:

Sequence, based on SEQRES records:

>d1dmla2 d.131.1.2 (A:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs
sststqvqilsnaltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlk
fflttpvpslcvtatgpnavsavfllkpqk

Sequence, based on observed residues (ATOM records):

>d1dmla2 d.131.1.2 (A:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegna
ktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslcvtatgpnavsavf
llkpqk

Timeline for d1dmla2:

• d1dmla2 first appeared (with stable ids) in SCOP 1.55
  
• d1dmla2 appears in SCOPe 2.02
  
• d1dmla2 appears in SCOPe 2.04
  
• d1dmla2 appears in the current release, SCOPe 2.08