Lineage for d4h7nd_ (4h7n D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909041Species Anabaena variabilis [TaxId:240292] [419905] (1 PDB entry)
  8. 2909045Domain d4h7nd_: 4h7n D: [413819]
    Other proteins in same PDB: d4h7na2
    automated match to d4itba_
    complexed with gol

Details for d4h7nd_

PDB Entry: 4h7n (more details), 2 Å

PDB Description: the structure of putative aldehyde dehydrogenase puta from anabaena variabilis.
PDB Compounds: (D:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4h7nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h7nd_ c.82.1.0 (D:) automated matches {Anabaena variabilis [TaxId: 240292]}
ktievrnprtgkfdyviipppprllaqqcnrarraqsrwqelgvegrittlqqwkqails
rreqltealvndtgrlsitvleidsflasidrwcglapellqtsakntsipfialqqslv
pyplvgvispwnfpltlsmidtipallagcavvvkpseiaprfvapllmalntvpelrdv
lifvegggetganlinyvdfvcftgsvatgrevaetaarrfipaylelggkdpaivlesa
nlelatsailwgavvntgqsclsieriyvaeskfeefyhqliakahrlqlayplvedgai
gpiiaekqagiindhildavekgavihcggkveelgggwwcrptvmtnvnhsmkvmteet
fgpimpvmpfpdveeavylandtiyglsaavfagsedealkvarqlnagaisindaalta
mmhegeknafnfsglggsrvgaaglkrflrkqafliktnstsdpwwfd

SCOPe Domain Coordinates for d4h7nd_:

Click to download the PDB-style file with coordinates for d4h7nd_.
(The format of our PDB-style files is described here.)

Timeline for d4h7nd_:

  • d4h7nd_ is new in SCOPe 2.08-stable