Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Anabaena variabilis [TaxId:240292] [419905] (1 PDB entry) |
Domain d4h7na1: 4h7n A:1-470 [413815] Other proteins in same PDB: d4h7na2 automated match to d4itba_ complexed with gol |
PDB Entry: 4h7n (more details), 2 Å
SCOPe Domain Sequences for d4h7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h7na1 c.82.1.0 (A:1-470) automated matches {Anabaena variabilis [TaxId: 240292]} mtktievrnprtgkfdyviipppprllaqqcnrarraqsrwqelgvegrittlqqwkqai lsrreqltealvndtgrlsitvleidsflasidrwcglapellqtsakntsipfialqqs lvpyplvgvispwnfpltlsmidtipallagcavvvkpseiaprfvapllmalntvpelr dvlifvegggetganlinyvdfvcftgsvatgrevaetaarrfipaylelggkdpaivle sanlelatsailwgavvntgqsclsieriyvaeskfeefyhqliakahrlqlayplvedg aigpiiaekqagiindhildavekgavihcggkveelgggwwcrptvmtnvnhsmkvmte etfgpimpvmpfpdveeavylandtiyglsaavfagsedealkvarqlnagaisindaal tammhegeknafnfsglggsrvgaaglkrflrkqafliktnstsdpwwfd
Timeline for d4h7na1: