Lineage for d3pmgb4 (3pmg B:421-561)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137429Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 137535Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
  5. 137536Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (2 proteins)
  6. 137543Protein Phosphoglucomutase [55959] (1 species)
  7. 137544Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 137546Domain d3pmgb4: 3pmg B:421-561 [41302]
    Other proteins in same PDB: d3pmga1, d3pmga2, d3pmga3, d3pmgb1, d3pmgb2, d3pmgb3

Details for d3pmgb4

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity

SCOP Domain Sequences for d3pmgb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmgb4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOP Domain Coordinates for d3pmgb4:

Click to download the PDB-style file with coordinates for d3pmgb4.
(The format of our PDB-style files is described here.)

Timeline for d3pmgb4: