![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphoglucomutase [53740] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
![]() | Domain d3pmgb1: 3pmg B:1-190 [35411] Other proteins in same PDB: d3pmga4, d3pmgb4 |
PDB Entry: 3pmg (more details), 2.4 Å
SCOP Domain Sequences for d3pmgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmgb1 c.84.1.1 (B:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)} vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf kpftveivds
Timeline for d3pmgb1:
![]() Domains from other chains: (mouse over for more information) d3pmga1, d3pmga2, d3pmga3, d3pmga4 |