Lineage for d3pmga4 (3pmg A:421-561)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83931Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
  5. 83932Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (1 protein)
  6. 83933Protein Phosphoglucomutase, C-terminal domain [55959] (1 species)
  7. 83934Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 83935Domain d3pmga4: 3pmg A:421-561 [41301]
    Other proteins in same PDB: d3pmga1, d3pmga2, d3pmga3, d3pmgb1, d3pmgb2, d3pmgb3

Details for d3pmga4

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity

SCOP Domain Sequences for d3pmga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmga4 d.129.2.1 (A:421-561) Phosphoglucomutase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOP Domain Coordinates for d3pmga4:

Click to download the PDB-style file with coordinates for d3pmga4.
(The format of our PDB-style files is described here.)

Timeline for d3pmga4: