Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein) |
Protein Phosphoglucomutase, first 3 domains [53740] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
Domain d3pmgb2: 3pmg B:191-303 [35412] Other proteins in same PDB: d3pmga4, d3pmgb4 |
PDB Entry: 3pmg (more details), 2.4 Å
SCOP Domain Sequences for d3pmgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmgb2 c.84.1.1 (B:191-303) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)} veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d3pmgb2:
View in 3D Domains from other chains: (mouse over for more information) d3pmga1, d3pmga2, d3pmga3, d3pmga4 |