SCOPe 2.08: Domain d1d3ua2: 1d3u A:93-181

Lineage for d1d3ua2 (1d3u A:93-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)

8. Domain d1d3ua2: 1d3u A:93-181 [41291]
   Other proteins in same PDB: d1d3ub1, d1d3ub2
   protein/DNA complex

Details for d1d3ua2

PDB Entry: 1d3u, 2.4 Å

PDB Description: tata-binding protein/transcription factor (ii)b/bre+tata-box complex from pyrococcus woesei

PDB Compounds: (A:) tata-binding protein

SCOPe Domain Sequences for d1d3ua2:

Sequence; same for both SEQRES and ATOM records:

>d1d3ua2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldky

Timeline for d1d3ua2:

• d1d3ua2 first appeared (with stable ids) in SCOP 1.55
  
• d1d3ua2 appears in SCOPe 2.07