SCOP 1.57: Domain d1qneb1: 1qne B:11-115

Lineage for d1qneb1 (1qne B:11-115)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1qneb1: 1qne B:11-115 [41248]

Details for d1qneb1

PDB Entry: 1qne, 1.9 Å

PDB Description: crystal structure of the adenovirus major late promoter tata box bound to wild-type tbp (arabidopsis thaliana tbp isoform 2).

SCOP Domain Sequences for d1qneb1:

Sequence; same for both SEQRES and ATOM records:

>d1qneb1 d.129.1.1 (B:11-115) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
pvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktt
alifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

Timeline for d1qneb1:

• d1qneb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qneb1 appears in SCOP 1.59
  
• d1qneb1 appears in the current release, SCOPe 2.08