Lineage for d1qneb1 (1qne B:11-115)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137429Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 137430Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 137431Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 137432Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 137433Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)
  8. 137452Domain d1qneb1: 1qne B:11-115 [41248]

Details for d1qneb1

PDB Entry: 1qne (more details), 1.9 Å

PDB Description: crystal structure of the adenovirus major late promoter tata box bound to wild-type tbp (arabidopsis thaliana tbp isoform 2).

SCOP Domain Sequences for d1qneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qneb1 d.129.1.1 (B:11-115) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
pvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktt
alifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

SCOP Domain Coordinates for d1qneb1:

Click to download the PDB-style file with coordinates for d1qneb1.
(The format of our PDB-style files is described here.)

Timeline for d1qneb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qneb2