Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.73: Non-antiporter membrane subunits from respiratory complex I [418733] (3 superfamilies) Three subunits form a single 11-helix bundle at the interface between the hydrophilic domain and the antiporter-like subunits |
Superfamily f.73.1: Respiratory complex I subunit NuoK-like [418777] (1 family) |
Family f.73.1.1: Respiratory complex I subunit NuoK-like [418866] (2 proteins) Pfam PF00420 |
Protein automated matches [419247] (2 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [420079] (1 PDB entry) |
Domain d6y11s_: 6y11 S: [412210] Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11p_, d6y11w_, d6y11x_ automated match to d4he8k_ complexed with fes, fmn, sf4 |
PDB Entry: 6y11 (more details), 3.11 Å
SCOPe Domain Sequences for d6y11s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y11s_ f.73.1.1 (S:) automated matches {Thermus thermophilus [TaxId: 274]} msylltsallfalgvygvltrrtailvflsielmlnaanlslvgfaraygldgqvaalmv iavaaaevavglglivaifrhrestavddlselrg
Timeline for d6y11s_:
View in 3D Domains from other chains: (mouse over for more information) d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11w_, d6y11x_ |