Lineage for d6y11s_ (6y11 S:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029574Fold f.73: Non-antiporter membrane subunits from respiratory complex I [418733] (3 superfamilies)
    Three subunits form a single 11-helix bundle at the interface between the hydrophilic domain and the antiporter-like subunits
  4. 3029575Superfamily f.73.1: Respiratory complex I subunit NuoK-like [418777] (1 family) (S)
  5. 3029576Family f.73.1.1: Respiratory complex I subunit NuoK-like [418866] (2 proteins)
    Pfam PF00420
  6. 3029582Protein automated matches [419247] (2 species)
    not a true protein
  7. 3029585Species Thermus thermophilus [TaxId:274] [420079] (1 PDB entry)
  8. 3029587Domain d6y11s_: 6y11 S: [412210]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11p_, d6y11w_, d6y11x_
    automated match to d4he8k_
    complexed with fes, fmn, sf4

Details for d6y11s_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (S:) NADH-quinone oxidoreductase subunit 11

SCOPe Domain Sequences for d6y11s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11s_ f.73.1.1 (S:) automated matches {Thermus thermophilus [TaxId: 274]}
msylltsallfalgvygvltrrtailvflsielmlnaanlslvgfaraygldgqvaalmv
iavaaaevavglglivaifrhrestavddlselrg

SCOPe Domain Coordinates for d6y11s_:

Click to download the PDB-style file with coordinates for d6y11s_.
(The format of our PDB-style files is described here.)

Timeline for d6y11s_:

  • d6y11s_ is new in SCOPe 2.08-stable