Lineage for d6y11d3 (6y11 D:247-685)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908420Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2908421Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (2 families) (S)
    molybdopterine enzyme
  5. 2908422Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2908536Protein automated matches [227025] (5 species)
    not a true protein
  7. 2908558Species Thermus thermophilus [TaxId:274] [393543] (1 PDB entry)
  8. 2908560Domain d6y11d3: 6y11 D:247-685 [393544]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug32
    complexed with fes, fmn, sf4

Details for d6y11d3

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (D:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d6y11d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11d3 c.81.1.1 (D:247-685) automated matches {Thermus thermophilus [TaxId: 274]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea
mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt
fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka
rkvpeamgrlsfrlkelrp

SCOPe Domain Coordinates for d6y11d3:

Click to download the PDB-style file with coordinates for d6y11d3.
(The format of our PDB-style files is described here.)

Timeline for d6y11d3: