Lineage for d1ordb3 (1ord B:570-730)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217580Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily)
    complex alpha+beta motif
  4. 1217581Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family) (S)
  5. 1217582Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein)
  6. 1217583Protein Ornithine decarboxylase C-terminal domain [55906] (1 species)
  7. 1217584Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries)
  8. 1217587Domain d1ordb3: 1ord B:570-730 [41125]
    Other proteins in same PDB: d1orda1, d1orda2, d1ordb1, d1ordb2
    complexed with plp

Details for d1ordb3

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1ordb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb3 d.125.1.1 (B:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy
earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin
nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn

SCOPe Domain Coordinates for d1ordb3:

Click to download the PDB-style file with coordinates for d1ordb3.
(The format of our PDB-style files is described here.)

Timeline for d1ordb3: