![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily) |
![]() | Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family) ![]() |
![]() | Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein) |
![]() | Protein Ornithine decarboxylase C-terminal domain [55906] (1 species) |
![]() | Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries) |
![]() | Domain d1ordb3: 1ord B:570-730 [41125] Other proteins in same PDB: d1orda1, d1orda2, d1ordb1, d1ordb2 |
PDB Entry: 1ord (more details), 3 Å
SCOP Domain Sequences for d1ordb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ordb3 d.125.1.1 (B:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a} aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn
Timeline for d1ordb3: