SCOP 1.55: Domain d1ordb1: 1ord B:1-107

Lineage for d1ordb1 (1ord B:1-107)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.7: Ornithine decarboxylase N-terminal "wing" domain [52251] (1 family)

5. Family c.23.7.1: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein)

6. Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species)

7. Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries)

8. Domain d1ordb1: 1ord B:1-107 [31275]
   Other proteins in same PDB: d1orda2, d1orda3, d1ordb2, d1ordb3

Details for d1ordb1

PDB Entry: 1ord, 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1ordb1:

Sequence; same for both SEQRES and ATOM records:

>d1ordb1 c.23.7.1 (B:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil

Timeline for d1ordb1:

• d1ordb1 appears in SCOP 1.57
  
• d1ordb1 appears in the current release, SCOPe 2.08