Class a: All alpha proteins [46456] (290 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein automated matches [191131] (3 species) not a true protein |
Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries) |
Domain d5gmzd1: 5gmz D:1-144 [410112] Other proteins in same PDB: d5gmzb2, d5gmzd2, d5gmzf2 automated match to d6htxb_ complexed with 6xu, cl, gol, ipa; mutant |
PDB Entry: 5gmz (more details), 1.7 Å
SCOPe Domain Sequences for d5gmzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gmzd1 a.62.1.1 (D:1-144) automated matches {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstlp
Timeline for d5gmzd1: