SCOPe 2.08: Domain d1vzea_: 1vze A:

Lineage for d1vzea_ (1vze A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d1vzea_: 1vze A: [41003]
   complexed with cb3, ump; mutant

Details for d1vzea_

PDB Entry: 1vze, 2.3 Å

PDB Description: l. casei thymidylate synthase mutant e60q ternary complex with dump and cb3717

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1vzea_:

Sequence; same for both SEQRES and ATOM records:

>d1vzea_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfgliksq
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkapefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d1vzea_:

• d1vzea_ first appeared (with stable ids) in SCOP 1.55, called d1vze__
  
• d1vzea_ appears in SCOPe 2.07