SCOPe 2.08: Domain d4tmsa_: 4tms A:

Lineage for d4tmsa_ (4tms A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d4tmsa_: 4tms A: [40995]
   complexed with po4; mutant

Details for d4tmsa_

PDB Entry: 4tms, 2.35 Å

PDB Description: plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4tmsa_:

Sequence; same for both SEQRES and ATOM records:

>d4tmsa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d4tmsa_:

• d4tmsa_ first appeared (with stable ids) in SCOP 1.55, called d4tms__
  
• d4tmsa_ appears in SCOPe 2.07