Lineage for d1dnaa_ (1dna A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83365Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 83366Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 83367Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 83379Protein Thymidylate synthase [55833] (7 species)
  7. 83394Species Escherichia coli [TaxId:562] [55834] (44 PDB entries)
  8. 83420Domain d1dnaa_: 1dna A: [40956]

Details for d1dnaa_

PDB Entry: 1dna (more details), 2.2 Å

PDB Description: d221(169)n mutant does not promote opening of the cofactor imidazolidine ring

SCOP Domain Sequences for d1dnaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnaa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscnvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1dnaa_:

Click to download the PDB-style file with coordinates for d1dnaa_.
(The format of our PDB-style files is described here.)

Timeline for d1dnaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dnab_