Lineage for d1eiyb5 (1eiy B:475-681)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136439Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 136440Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 136441Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 136524Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
  7. 136525Species Thermus thermophilus (Thermus aquaticus) [55704] (5 PDB entries)
  8. 136530Domain d1eiyb5: 1eiy B:475-681 [40782]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb6

Details for d1eiyb5

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d1eiyb5:

Click to download the PDB-style file with coordinates for d1eiyb5.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb5: