Class a: All alpha proteins [46456] (151 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) |
Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) |
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) |
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries) |
Domain d1eiyb1: 1eiy B:1-38,B:152-190 [16305] Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6 |
PDB Entry: 1eiy (more details), 3.3 Å
SCOP Domain Sequences for d1eiyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)} mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg lardlhalgyalvepeaa
Timeline for d1eiyb1: