SCOPe 2.08: Domain d6xi4b_: 6xi4 B:

Lineage for d6xi4b_ (6xi4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187020] (7 PDB entries)

8. Domain d6xi4b_: 6xi4 B: [407334]
   automated match to d2p5xa_
   complexed with cl, so4

Details for d6xi4b_

PDB Entry: 6xi4, 2.22 Å

PDB Description: crystal structure of maf domain of human n-acetylserotonin o- methyltransferase-like protein soaked with tfbq

PDB Compounds: (B:) Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein

SCOPe Domain Sequences for d6xi4b_:

Sequence; same for both SEQRES and ATOM records:

>d6xi4b_ c.51.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
hgdflnvvgfplnhfckqlvklyy

Timeline for d6xi4b_:

• d6xi4b_ first appeared in SCOPe 2.07