Lineage for d2p5xa_ (2p5x A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the restSuperfamily c.51.4: ITPase-like [52972] (4 families) 
formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
Family c.51.4.0: automated matches [191335] (1 protein)
not a true familyProtein automated matches [190179] (9 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187020] (7 PDB entries) 
Domain d2p5xa_: 2p5x A: [243413]
automated match to d1ex2a_
complexed with po4
Details for d2p5xa_
PDB Entry: 2p5x (more details), 2 Å
PDB Description: Crystal structure of Maf domain of human N-acetylserotonin O-methyltransferase-like protein
PDB Compounds: (A:) N-acetylserotonin O-methyltransferase-like proteinSCOPe Domain Sequences for d2p5xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5xa_ c.51.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
hgdflnvvgfplnhfckqlvklyy
SCOPe Domain Coordinates for d2p5xa_:
Click to download the PDB-style file with coordinates for d2p5xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p5xa_:
- d2p5xa_ first appeared in SCOPe 2.04
- d2p5xa_ appears in SCOPe 2.07
View in 3D
