Lineage for d1b9lb_ (1b9l B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1919693Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 1919741Protein 7,8-dihydroneopterin triphosphate epimerase [55631] (1 species)
  7. 1919742Species Escherichia coli [TaxId:562] [55632] (1 PDB entry)
  8. 1919744Domain d1b9lb_: 1b9l B: [40666]

Details for d1b9lb_

PDB Entry: 1b9l (more details), 2.9 Å

PDB Description: 7,8-dihydroneopterin triphosphate epimerase
PDB Compounds: (B:) protein (epimerase)

SCOPe Domain Sequences for d1b9lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9lb_ d.96.1.3 (B:) 7,8-dihydroneopterin triphosphate epimerase {Escherichia coli [TaxId: 562]}
aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr

SCOPe Domain Coordinates for d1b9lb_:

Click to download the PDB-style file with coordinates for d1b9lb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9lb_: