Lineage for d7n0id_ (7n0i D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008871Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 3008872Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 3008883Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 3008902Protein automated matches [190565] (3 species)
    not a true protein
  7. 3008914Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384480] (11 PDB entries)
  8. 3008944Domain d7n0id_: 7n0i D: [405690]
    Other proteins in same PDB: d7n0ii1, d7n0ii2, d7n0ij1, d7n0ij2, d7n0ik1, d7n0ik2, d7n0il1, d7n0il2
    automated match to d2giba1
    complexed with act, mg

Details for d7n0id_

PDB Entry: 7n0i (more details), 2.2 Å

PDB Description: structure of the sars-cov-2 n protein c-terminal domain bound to single-domain antibody e2
PDB Compounds: (D:) nucleoprotein

SCOPe Domain Sequences for d7n0id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7n0id_ d.254.1.2 (D:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
nvtqafgrrgpeqtqgnfgdqelirqgtdykhwpqiaqfapsasaffgmsrigmevtpsg
twltytgaiklddkdpnfkdqvillnkhidayktfp

SCOPe Domain Coordinates for d7n0id_:

Click to download the PDB-style file with coordinates for d7n0id_.
(The format of our PDB-style files is described here.)

Timeline for d7n0id_: