Lineage for d1fu0b_ (1fu0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965952Species Enterococcus faecalis [TaxId:1351] [55598] (3 PDB entries)
  8. 2965954Domain d1fu0b_: 1fu0 B: [40551]
    contains phospho-serine 46

Details for d1fu0b_

PDB Entry: 1fu0 (more details), 1.9 Å

PDB Description: crystal structure analysis of the phospho-serine 46 hpr from enterococcus faecalis
PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1fu0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu0b_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Enterococcus faecalis [TaxId: 1351]}
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla

SCOPe Domain Coordinates for d1fu0b_:

Click to download the PDB-style file with coordinates for d1fu0b_.
(The format of our PDB-style files is described here.)

Timeline for d1fu0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fu0a_