PDB entry 1fu0

View 1fu0 on RCSB PDB site
Description: crystal structure analysis of the phospho-serine 46 hpr from enterococcus faecalis
Class: signaling protein
Keywords: Phospho-Serine HPr, PTS System, SIGNALING PROTEIN
Deposited on 2000-09-13, released 2000-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein HPr
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07515
      • phosphorylation (45)
    Domains in SCOPe 2.08: d1fu0a_
  • Chain 'B':
    Compound: Phosphocarrier protein HPr
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07515 (0-86)
      • phosphorylation (45)
    Domains in SCOPe 2.08: d1fu0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fu0A (A:)
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fu0B (B:)
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla