| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
| Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
| Protein automated matches [190507] (3 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [377998] (5 PDB entries) |
| Domain d7dz7z_: 7dz7 Z: [405210] Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7v_ automated match to d5xnl3_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz7 (more details), 2.84 Å
SCOPe Domain Sequences for d7dz7z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz7z_ f.43.1.1 (Z:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rrtvkpaskastpdsfwygperplflgaftgeppsyltgefpgdygwdtaglsadpetfk
ryreleliharwamlgalgcifpellgsygvpfgeavwfkagaqifqeggldylgnpnlv
haqsilailgtqvllmgaiegyrvnggplgegldklypggsfdplgladdpdtfaelkvk
eikngrlamfsmfgffvqaivtgkgplqnlsdhlanpgtnnafayatkftpq
Timeline for d7dz7z_: