Lineage for d7dz7z_ (7dz7 Z:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028389Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [377998] (5 PDB entries)
  8. 3028394Domain d7dz7z_: 7dz7 Z: [405210]
    Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7v_
    automated match to d5xnl3_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz7z_

PDB Entry: 7dz7 (more details), 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii
PDB Compounds: (Z:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7dz7z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz7z_ f.43.1.1 (Z:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rrtvkpaskastpdsfwygperplflgaftgeppsyltgefpgdygwdtaglsadpetfk
ryreleliharwamlgalgcifpellgsygvpfgeavwfkagaqifqeggldylgnpnlv
haqsilailgtqvllmgaiegyrvnggplgegldklypggsfdplgladdpdtfaelkvk
eikngrlamfsmfgffvqaivtgkgplqnlsdhlanpgtnnafayatkftpq

SCOPe Domain Coordinates for d7dz7z_:

Click to download the PDB-style file with coordinates for d7dz7z_.
(The format of our PDB-style files is described here.)

Timeline for d7dz7z_: