SCOPe 2.08: Domain d7dz7j_: 7dz7 J:

Lineage for d7dz7j_ (7dz7 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.0: automated matches [276196] (1 protein)
   not a true family

6. Protein automated matches [276198] (5 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370433] (7 PDB entries)

8. Domain d7dz7j_: 7dz7 J: [405225]
   Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7u_, d7dz7v_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_
   automated match to d5l8rj_
   complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz7j_

PDB Entry: 7dz7, 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii

PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d7dz7j_:

Sequence; same for both SEQRES and ATOM records:

>d7dz7j_ f.23.18.0 (J:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mkdfttylstapviatiwftftagllieinryfpdplvfsf

Timeline for d7dz7j_:

• d7dz7j_ first appeared in SCOPe 2.07