Lineage for d7dftf1 (7dft F:24-197)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461305Species Xanthomonas oryzae [TaxId:347] [404983] (1 PDB entry)
  8. 2461307Domain d7dftf1: 7dft F:24-197 [405099]
    Other proteins in same PDB: d7dfta_, d7dftb_, d7dftd_, d7dfte_, d7dftg_
    automated match to d3mt6w_
    complexed with cl

Details for d7dftf1

PDB Entry: 7dft (more details), 1.8 Å

PDB Description: crystal structure of xanthomonas oryzae clpp
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d7dftf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dftf1 c.14.1.1 (F:24-197) automated matches {Xanthomonas oryzae [TaxId: 347]}
aydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiyinspggvvtagma
iydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfqgqatdi
dihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvl

SCOPe Domain Coordinates for d7dftf1:

Click to download the PDB-style file with coordinates for d7dftf1.
(The format of our PDB-style files is described here.)

Timeline for d7dftf1: