Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (15 species) not a true protein |
Species Xanthomonas oryzae [TaxId:347] [404983] (1 PDB entry) |
Domain d7dftf1: 7dft F:24-197 [405099] Other proteins in same PDB: d7dfta_, d7dftb_, d7dftd_, d7dfte_, d7dftg_ automated match to d3mt6w_ complexed with cl |
PDB Entry: 7dft (more details), 1.8 Å
SCOPe Domain Sequences for d7dftf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dftf1 c.14.1.1 (F:24-197) automated matches {Xanthomonas oryzae [TaxId: 347]} aydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiyinspggvvtagma iydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfqgqatdi dihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvl
Timeline for d7dftf1: