Lineage for d7dfta_ (7dft A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462710Species Xanthomonas oryzae [TaxId:347] [404965] (2 PDB entries)
  8. 2462711Domain d7dfta_: 7dft A: [405035]
    Other proteins in same PDB: d7dftc1, d7dftf1
    automated match to d1tg6f_
    complexed with cl

Details for d7dfta_

PDB Entry: 7dft (more details), 1.8 Å

PDB Description: crystal structure of xanthomonas oryzae clpp
PDB Compounds: (A:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d7dfta_:

Sequence, based on SEQRES records: (download)

>d7dfta_ c.14.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 347]}
vpmvveqtsrgeraydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiy
inspggvvtagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmih
qplggfqgqatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqay
glvdqvle

Sequence, based on observed residues (ATOM records): (download)

>d7dfta_ c.14.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 347]}
vpmvvaydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiyinspggvv
tagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfqg
qatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvle

SCOPe Domain Coordinates for d7dfta_:

Click to download the PDB-style file with coordinates for d7dfta_.
(The format of our PDB-style files is described here.)

Timeline for d7dfta_: