Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Xanthomonas oryzae [TaxId:347] [404965] (2 PDB entries) |
Domain d7dfta_: 7dft A: [405035] Other proteins in same PDB: d7dftc1, d7dftf1 automated match to d1tg6f_ complexed with cl |
PDB Entry: 7dft (more details), 1.8 Å
SCOPe Domain Sequences for d7dfta_:
Sequence, based on SEQRES records: (download)
>d7dfta_ c.14.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 347]} vpmvveqtsrgeraydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiy inspggvvtagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmih qplggfqgqatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqay glvdqvle
>d7dfta_ c.14.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 347]} vpmvvaydiysrllkerliflvgpiddhmanvivaqllfleadnpekdisiyinspggvv tagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfqg qatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvle
Timeline for d7dfta_: