SCOPe 2.08: Domain d7dxhh_: 7dxh h:

Lineage for d7dxhh_ (7dxh h:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)

8. Domain d7dxhh_: 7dxh h: [405077]
   Other proteins in same PDB: d7dxha_, d7dxhb_, d7dxhc_, d7dxhd_, d7dxhe_, d7dxhf_, d7dxhi_, d7dxhk_, d7dxhl_, d7dxhm_, d7dxht_, d7dxhx_, d7dxhz_
   automated match to d5v2ch_
   complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl

Details for d7dxhh_

PDB Entry: 7dxh, 3.14 Å

PDB Description: cryo-em structure of psii intermediate psb28-psii complex

PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7dxhh_:

Sequence; same for both SEQRES and ATOM records:

>d7dxhh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wk

Timeline for d7dxhh_:

• d7dxhh_ first appeared in SCOPe 2.07