Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
Domain d7dxhh_: 7dxh h: [405077] Other proteins in same PDB: d7dxha_, d7dxhb_, d7dxhc_, d7dxhd_, d7dxhe_, d7dxhf_, d7dxhi_, d7dxhk_, d7dxhl_, d7dxhm_, d7dxht_, d7dxhx_, d7dxhz_ automated match to d5v2ch_ complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl |
PDB Entry: 7dxh (more details), 3.14 Å
SCOPe Domain Sequences for d7dxhh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dxhh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wk
Timeline for d7dxhh_: