SCOPe 2.08: Domain d7ddqm_: 7ddq M:

Lineage for d7ddqm_ (7ddq M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [405012] (1 PDB entry)

8. Domain d7ddqm_: 7ddq M: [405067]
   Other proteins in same PDB: d7ddqa_, d7ddqb_, d7ddqd_, d7ddqe_, d7ddqf_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddqn_, d7ddqo_, d7ddqr_, d7ddqs_, d7ddqt_, d7ddqu_
   automated match to d2j8dm_
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqm_

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d7ddqm_:

Sequence; same for both SEQRES and ATOM records:

>d7ddqm_ f.26.1.1 (M:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
eyqniftqvqvagkpelgmvegvnlenrttgttnwpilgwfgnaqlgpiylgtlgtmsli
fgafwfflvgvsfiiqadyspalflrelfraglfppapeyglslsaplmegglwliasff
lmlsvllwwartykraadlgmgkhtawafagalwlmfvlsffrpilmgswseavpygifp
hldwtnnfslthgnlfynpfhglsiaflygstmlfamhgatilavsrlggereleqivdr
gtaaeraalfwrwtmgfnatmegihrwgwwfavltpvtggigillsgtvvedwsvwaqvh
gykal

Timeline for d7ddqm_:

• d7ddqm_ first appeared in SCOPe 2.07