Lineage for d1ad5b2 (1ad5 B:146-248)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82520Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 82521Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 82524Domain d1ad5b2: 1ad5 B:146-248 [40492]
    Other proteins in same PDB: d1ad5a1, d1ad5a3, d1ad5b1, d1ad5b3

Details for d1ad5b2

PDB Entry: 1ad5 (more details), 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

SCOP Domain Sequences for d1ad5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad5b2 d.93.1.1 (B:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOP Domain Coordinates for d1ad5b2:

Click to download the PDB-style file with coordinates for d1ad5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ad5b2: