Lineage for d1ad5b3 (1ad5 B:249-531)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84533Family d.144.1.2: Tyrosine kinase [56150] (9 proteins)
  6. 84559Protein Haemopoetic cell kinase Hck [56151] (1 species)
  7. 84560Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries)
  8. 84563Domain d1ad5b3: 1ad5 B:249-531 [41682]
    Other proteins in same PDB: d1ad5a1, d1ad5a2, d1ad5b1, d1ad5b2

Details for d1ad5b3

PDB Entry: 1ad5 (more details), 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

SCOP Domain Sequences for d1ad5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad5b3 d.144.1.2 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

SCOP Domain Coordinates for d1ad5b3:

Click to download the PDB-style file with coordinates for d1ad5b3.
(The format of our PDB-style files is described here.)

Timeline for d1ad5b3: