Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries) |
Domain d6zh5i1: 6zh5 I:2-183 [404392] Other proteins in same PDB: d6zh5a2, d6zh5b2, d6zh5c2, d6zh5d2, d6zh5e2, d6zh5f2, d6zh5g2, d6zh5h2, d6zh5i2, d6zh5j2, d6zh5k2, d6zh5l2, d6zh5m2, d6zh5n2, d6zh5o2, d6zh5p2, d6zh5q2, d6zh5r2, d6zh5s2, d6zh5t2, d6zh5u2, d6zh5v2, d6zh5w2, d6zh5z2 automated match to d1iera_ complexed with fe |
PDB Entry: 6zh5 (more details), 2.7 Å
SCOPe Domain Sequences for d6zh5i1:
Sequence, based on SEQRES records: (download)
>d6zh5i1 a.25.1.1 (I:2-183) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk hd
>d6zh5i1 a.25.1.1 (I:2-183) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar adphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlkhd
Timeline for d6zh5i1:
View in 3D Domains from other chains: (mouse over for more information) d6zh5a1, d6zh5a2, d6zh5b1, d6zh5b2, d6zh5c1, d6zh5c2, d6zh5d1, d6zh5d2, d6zh5e1, d6zh5e2, d6zh5f1, d6zh5f2, d6zh5g1, d6zh5g2, d6zh5h1, d6zh5h2, d6zh5j1, d6zh5j2, d6zh5k1, d6zh5k2, d6zh5l1, d6zh5l2, d6zh5m1, d6zh5m2, d6zh5n1, d6zh5n2, d6zh5o1, d6zh5o2, d6zh5p1, d6zh5p2, d6zh5q1, d6zh5q2, d6zh5r1, d6zh5r2, d6zh5s1, d6zh5s2, d6zh5t1, d6zh5t2, d6zh5u1, d6zh5u2, d6zh5v1, d6zh5v2, d6zh5w1, d6zh5w2, d6zh5z1, d6zh5z2 |