Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Thermolysin [63414] (3 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [279445] (12 PDB entries) |
Domain d6ymre_: 6ymr E: [404240] automated match to d1kkka_ complexed with ca, dms, oze, zn |
PDB Entry: 6ymr (more details), 1.6 Å
SCOPe Domain Sequences for d6ymre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ymre_ d.92.1.2 (E:) Thermolysin {Geobacillus stearothermophilus [TaxId: 1422]} itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d6ymre_: