Lineage for d6yjfa1 (6yjf A:2-416)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910396Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2910433Protein automated matches [190709] (5 species)
    not a true protein
  7. 2910475Species Plasmodium vivax [TaxId:5855] [381605] (3 PDB entries)
  8. 2910478Domain d6yjfa1: 6yjf A:2-416 [404172]
    Other proteins in same PDB: d6yjfa2
    automated match to d1qpga_
    complexed with gol, otq

Details for d6yjfa1

PDB Entry: 6yjf (more details), 1.85 Å

PDB Description: plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from pegsmear at ph 6.5
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d6yjfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yjfa1 c.86.1.1 (A:2-416) automated matches {Plasmodium vivax [TaxId: 5855]}
lgnklsitdvkaiqgkkvlvrvdfnvpiengvikdtnritatlptihhlkkegaakiili
shcgrpdgtknlkytlkpvaetlgtllgeevlflsdcvgeevaaqinqakdnsvillenl
rfhveeegkgvdaagnkikaskedmekfqneltklgdvfindafgtahrahssmvgikmn
vkasgflmkkeleyfskalenpqrpllailggakvsdkiqliknlldkvdkmiigggmay
tfkyvlnnmkigdslfdeagskivneimekakaknveiylpvdfkvadkfdnnantkvvt
deegiedkwmgldagpksienykdvilssktiiwngpqgvfempnfakgsieclnlviea
tkkgaisivgggdtaslveqqqkkneishvstgggaslellegkelpgvvalssk

SCOPe Domain Coordinates for d6yjfa1:

Click to download the PDB-style file with coordinates for d6yjfa1.
(The format of our PDB-style files is described here.)

Timeline for d6yjfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6yjfa2