Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55533] (22 PDB entries) |
Domain d1a85a_: 1a85 A: [40355] complexed with 0dy, ca, zn |
PDB Entry: 1a85 (more details), 2 Å
SCOPe Domain Sequences for d1a85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a85a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg lahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d1a85a_: