Lineage for d1a85a_ (1a85 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 868017Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 868018Species Human (Homo sapiens) [TaxId:9606] [55533] (19 PDB entries)
  8. 868035Domain d1a85a_: 1a85 A: [40355]
    complexed with ca, hmi, zn

Details for d1a85a_

PDB Entry: 1a85 (more details), 2 Å

PDB Description: mmp8 with malonic and asparagine based inhibitor
PDB Compounds: (A:) mmp-8

SCOP Domain Sequences for d1a85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a85a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOP Domain Coordinates for d1a85a_:

Click to download the PDB-style file with coordinates for d1a85a_.
(The format of our PDB-style files is described here.)

Timeline for d1a85a_: