Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-2 (IL-2) [47301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47302] (19 PDB entries) |
Domain d7dr4g_: 7dr4 G: [403251] Other proteins in same PDB: d7dr4b1, d7dr4d1, d7dr4d2, d7dr4f1, d7dr4f2, d7dr4l1, d7dr4l2 automated match to d1m47a_ |
PDB Entry: 7dr4 (more details), 2.49 Å
SCOPe Domain Sequences for d7dr4g_:
Sequence, based on SEQRES records: (download)
>d7dr4g_ a.26.1.2 (G:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} kktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkple evlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfcqs iistlt
>d7dr4g_ a.26.1.2 (G:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} kktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkple evlnlaqsknfhlrprdlisninvivlelkgtfmceyadetativeflnrwitfcqsiis tlt
Timeline for d7dr4g_: