SCOPe 2.07: Domain d7dr4d2: 7dr4 D:108-213

Lineage for d7dr4d2 (7dr4 D:108-213)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d7dr4d2: 7dr4 D:108-213 [403320]
Other proteins in same PDB: d7dr4b1, d7dr4d1, d7dr4f1, d7dr4g_, d7dr4i_, d7dr4j_, d7dr4k_, d7dr4l1
automated match to d1h3pl2

Details for d7dr4d2

PDB Entry: 7dr4 (more details), 2.49 Å

PDB Description: complex of anti-human il-2 antibody and human il-2

PDB Compounds: (D:) anti-human IL-2 antibody, mouse Ig G, kappa chain

SCOPe Domain Sequences for d7dr4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dr4d2 b.1.1.2 (D:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d7dr4d2:

Click to download the PDB-style file with coordinates for d7dr4d2.
(The format of our PDB-style files is described here.)

Timeline for d7dr4d2: