SCOPe 2.08: Domain d7d34b1: 7d34 B:79-156

Lineage for d7d34b1 (7d34 B:79-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.0: automated matches [191583] (1 protein)
   not a true family

6. Protein automated matches [191039] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [403226] (1 PDB entry)

8. Domain d7d34b1: 7d34 B:79-156 [403230]
   Other proteins in same PDB: d7d34a2, d7d34b2
   automated match to d4yjxa_
   complexed with acy, ala, phe

Details for d7d34b1

PDB Entry: 7d34, 2.01 Å

PDB Description: atclps1-peptide complex

PDB Compounds: (B:) ATP-dependent Clp protease adapter protein CLPS1, chloroplastic

SCOPe Domain Sequences for d7d34b1:

Sequence; same for both SEQRES and ATOM records:

>d7d34b1 d.45.1.0 (B:79-156) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
appyrvilhndnfnkreyvvqvlmkvipgmtvdnavnimqeahinglavvivcaqadaeq
hcmqlrgngllssvepdg

Timeline for d7d34b1:

• d7d34b1 first appeared in SCOPe 2.07