PDB entry 7d34

View 7d34 on RCSB PDB site
Description: AtClpS1-peptide complex
Class: peptide binding protein
Keywords: Arabidopsis thaliana, ClpS, N-degron pathway, complex structure, PEPTIDE BINDING PROTEIN
Deposited on 2020-09-18, released 2021-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein CLPS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CPLS1, CLPT, At1g68660, F24J5.10, F24J5.4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SX29 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d7d34a1, d7d34a2
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein CLPS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CPLS1, CLPT, At1g68660, F24J5.10, F24J5.4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SX29 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d7d34b1, d7d34b2
  • Heterogens: ACY, PHE, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7d34A (A:)
lappyrvilhndnfnkreyvvqvlmkvipgmtvdnavnimqeahinglavvivcaqadae
qhcmqlrgngllssvepdgggc

    Sequence, based on observed residues (ATOM records): (download) 
    >7d34A (A:)
lappyrvilhndnfnkreyvvqvlmkvipgmtvdnavnimqeahinglavvivcaqadae
qhcmqlrgngllssvepdg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7d34B (B:)
lappyrvilhndnfnkreyvvqvlmkvipgmtvdnavnimqeahinglavvivcaqadae
qhcmqlrgngllssvepdgggc

    Sequence, based on observed residues (ATOM records): (download) 
    >7d34B (B:)
lappyrvilhndnfnkreyvvqvlmkvipgmtvdnavnimqeahinglavvivcaqadae
qhcmqlrgngllssvepdg