Lineage for d6z3db_ (6z3d B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702643Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries)
  8. 2702669Domain d6z3db_: 6z3d B: [402885]
    automated match to d1iera_
    complexed with act

Details for d6z3db_

PDB Entry: 6z3d (more details), 1.7 Å

PDB Description: l-ferritinmsa
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d6z3db_:

Sequence, based on SEQRES records: (download)

>d6z3db_ a.25.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekr
egaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsa
radphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltl
kh

Sequence, based on observed residues (ATOM records): (download)

>d6z3db_ a.25.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekr
egaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsa
radphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlkh

SCOPe Domain Coordinates for d6z3db_:

Click to download the PDB-style file with coordinates for d6z3db_.
(The format of our PDB-style files is described here.)

Timeline for d6z3db_: