Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d7ndvh1: 7ndv H:20-229 [402515] Other proteins in same PDB: d7ndvh2 automated match to d3u8kd_ complexed with nag, so4, u8q |
PDB Entry: 7ndv (more details), 1.7 Å
SCOPe Domain Sequences for d7ndvh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ndvh1 b.96.1.1 (H:20-229) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkgrseil
Timeline for d7ndvh1: