SCOPe 2.08: Domain d7ndvh1: 7ndv H:20-229

Lineage for d7ndvh1 (7ndv H:20-229)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d7ndvh1: 7ndv H:20-229 [402515]
   Other proteins in same PDB: d7ndvh2
   automated match to d3u8kd_
   complexed with nag, so4, u8q

Details for d7ndvh1

PDB Entry: 7ndv, 1.7 Å

PDB Description: x-ray structure of acetylcholine-binding protein (achbp) in complex with fl001888.

PDB Compounds: (H:) acetylcholine-binding protein

SCOPe Domain Sequences for d7ndvh1:

Sequence; same for both SEQRES and ATOM records:

>d7ndvh1 b.96.1.1 (H:20-229) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrseil

Timeline for d7ndvh1:

• d7ndvh1 first appeared in SCOPe 2.07