SCOPe 2.08: Domain d7lo2c1: 7lo2 C:3-100

Lineage for d7lo2c1 (7lo2 C:3-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries)

8. Domain d7lo2c1: 7lo2 C:3-100 [402378]
   Other proteins in same PDB: d7lo2a3, d7lo2b3, d7lo2c3, d7lo2d3
   automated match to d1mxaa1
   complexed with edo, k, mg, pg4, po4, pop

Details for d7lo2c1

PDB Entry: 7lo2, 1.89 Å

PDB Description: s-adenosylmethionine synthetase cocrystallized with ctp

PDB Compounds: (C:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7lo2c1:

Sequence; same for both SEQRES and ATOM records:

>d7lo2c1 d.130.1.0 (C:3-100) automated matches {Escherichia coli [TaxId: 1268998]}
hlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsawv
dieeitrntvreigyvhsdmgfdanscavlsaigkqsp

Timeline for d7lo2c1:

• d7lo2c1 first appeared in SCOPe 2.07