Lineage for d7ljuc3 (7lju C:288-440)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457627Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2457640Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 2457641Species Pig (Sus scrofa) [TaxId:9823] [51912] (9 PDB entries)
  8. 2457660Domain d7ljuc3: 7lju C:288-440 [402316]
    Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua4, d7ljua5, d7ljub1, d7ljub2, d7ljub4, d7ljub5, d7ljuc1, d7ljuc2, d7ljuc4, d7ljuc5, d7ljud1, d7ljud2, d7ljud4, d7ljud5
    automated match to d1gtea3
    complexed with fad, fnr, nap, sf4, y3g

Details for d7ljuc3

PDB Entry: 7lju (more details), 1.87 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu)
PDB Compounds: (C:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljuc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljuc3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d7ljuc3:

Click to download the PDB-style file with coordinates for d7ljuc3.
(The format of our PDB-style files is described here.)

Timeline for d7ljuc3: