Lineage for d7ljub2 (7lju B:184-287,B:441-532)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458575Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2458576Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2458577Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2458590Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 2458591Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries)
  8. 2458609Domain d7ljub2: 7lju B:184-287,B:441-532 [402258]
    Other proteins in same PDB: d7ljua1, d7ljua3, d7ljua4, d7ljua5, d7ljub1, d7ljub3, d7ljub4, d7ljub5, d7ljuc1, d7ljuc3, d7ljuc4, d7ljuc5, d7ljud1, d7ljud3, d7ljud4, d7ljud5
    automated match to d1gtea4
    complexed with fad, fnr, nap, sf4, y3g

Details for d7ljub2

PDB Entry: 7lju (more details), 1.87 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu)
PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljub2 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d7ljub2:

Click to download the PDB-style file with coordinates for d7ljub2.
(The format of our PDB-style files is described here.)

Timeline for d7ljub2: