![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries) |
![]() | Domain d7ljub2: 7lju B:184-287,B:441-532 [402258] Other proteins in same PDB: d7ljua1, d7ljua3, d7ljua4, d7ljua5, d7ljub1, d7ljub3, d7ljub4, d7ljub5, d7ljuc1, d7ljuc3, d7ljuc4, d7ljuc5, d7ljud1, d7ljud3, d7ljud4, d7ljud5 automated match to d1gtea4 complexed with fad, fnr, nap, sf4, y3g |
PDB Entry: 7lju (more details), 1.87 Å
SCOPe Domain Sequences for d7ljub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljub2 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d7ljub2:
![]() Domains from same chain: (mouse over for more information) d7ljub1, d7ljub3, d7ljub4, d7ljub5 |